SCOPe 2.03: Domain d4hoxa1: 4hox A:43-520

Lineage for d4hoxa1 (4hox A:43-520)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (14 species)
   not a true protein

7. Species Erwinia rhapontici [TaxId:55212] [228311] (5 PDB entries)

8. Domain d4hoxa1: 4hox A:43-520 [228926]
   Other proteins in same PDB: d4hoxa2
   automated match to d3gbda1
   complexed with ca, gol, trs

Details for d4hoxa1

PDB Entry: 4hox, 2 Å

PDB Description: The crystal structure of isomaltulose synthase from Erwinia rhapontici NX5 in complex with Tris

PDB Compounds: (A:) Sucrose isomerase

SCOPe Domain Sequences for d4hoxa1:

Sequence; same for both SEQRES and ATOM records:

>d4hoxa1 c.1.8.1 (A:43-520) automated matches {Erwinia rhapontici [TaxId: 55212]}
alptwwkqavfyqvyprsfkdtngdgigdlngiienldylkklgidaiwinphydspntd
ngydirdyrkimkeygtmedfdrlisemkkrnmrlmidivinhtsdqhawfvqsksgknn
pyrdyyfwrdgkdghapnnypsffggsawekddksgqyylhyfakqqpdlnwdnpkvrqd
lydmlrfwldkgvsglrfdtvatyskipnfpdlsqqqlknfaeeytkgpkihdyvnemnr
evlshydiatageifgvpldksikffdrrrnelniaftfdlirldrdaderwrrkdwtls
qfrkivdkvdqtageygwnaffldnhdnpravshfgddrpqwrehaakalatltltqrat
pfiyqgselgmtnypfkkiddfddvevkgfwqdyvetgkvkaeeflqnvrqtsrdnsrtp
fqwdasknagftsgtpwlkinpnykeinsadqinnpnsvfnyyrklinirhdipalty

Timeline for d4hoxa1:

• d4hoxa1 is new in SCOPe 2.03-stable
  
• d4hoxa1 appears in SCOPe 2.04
  
• d4hoxa1 appears in the current release, SCOPe 2.08