Lineage for d4hmna_ (4hmn A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2080914Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 protein domains)
    Common fold covers whole protein structure
  6. 2081137Protein Prostaglandin d2 11-ketoreductase (akr1c3) [102051] (1 species)
    Aldo-keto reductase family 1 member c3
  7. 2081138Species Human (Homo sapiens) [TaxId:9606] [102052] (43 PDB entries)
    Uniprot P42330
  8. 2081184Domain d4hmna_: 4hmn A: [228925]
    automated match to d4fala_
    complexed with 16j, edo, nap

Details for d4hmna_

PDB Entry: 4hmn (more details), 2.4 Å

PDB Description: Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 5 in complex with (4-(4-Chlorophenyl)piperazin-1-yl)(morpholino)methanone (24)
PDB Compounds: (A:) Aldo-keto reductase family 1 member C3

SCOPe Domain Sequences for d4hmna_:

Sequence, based on SEQRES records: (download)

>d4hmna_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]}
qcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeqvglai
rskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkpg
eelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglkyk
pvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcala
kkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlhy
fnsdsfashpnypysdey

Sequence, based on observed residues (ATOM records): (download)

>d4hmna_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]}
qcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeqvglai
rskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkpv
ifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglkykpvcnqvechpyf
nrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcalakkhkrtpalial
ryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlhyfnsdsfashpny
pysdey

SCOPe Domain Coordinates for d4hmna_:

Click to download the PDB-style file with coordinates for d4hmna_.
(The format of our PDB-style files is described here.)

Timeline for d4hmna_: