Lineage for d4ho1x_ (4ho1 X:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907393Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2907502Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)
  7. 2907529Species Haemophilus influenzae [TaxId:727] [142746] (3 PDB entries)
    Uniprot P45040 2-311
  8. 2907531Domain d4ho1x_: 4ho1 X: [228924]
    automated match to d1y7la1
    complexed with edo, gol

Details for d4ho1x_

PDB Entry: 4ho1 (more details), 1.86 Å

PDB Description: The Crystal structure of Haemophilus influenzae O-acetylserine sulfhydrylase at 1.85A resolution
PDB Compounds: (X:) Cysteine synthase

SCOPe Domain Sequences for d4ho1x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ho1x_ c.79.1.1 (X:) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]}
aiyadnsysigntplvrlkhfghngnvvvkiegrnpsysvkcriganmvwqaekdgtltk
gkeivdatsgntgialayvaaargykitltmpetmslerkrllcglgvnlvltegakgmk
gaiakaeeivasdpsryvmlkqfenpanpqihrettgpeiwkdtdgkvdvvvagvgtggs
itgisraikldfgkqitsvavepvespvisqtlageevkpgphkiqgigagfipknldls
iidrvetvdsdtalatarrlmaeegilagissgaavaaadrlaklpefadklivvilpsa
serylstalf

SCOPe Domain Coordinates for d4ho1x_:

Click to download the PDB-style file with coordinates for d4ho1x_.
(The format of our PDB-style files is described here.)

Timeline for d4ho1x_: