Lineage for d1zib__ (1zib -)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) Superfamily b.6.1: Cupredoxins [49503] (5 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins) 
Protein Pseudoazurin [49522] (4 species) Species Achromobacter cycloclastes [TaxId:223] [49525] (4 PDB entries) 
Domain d1zib__: 1zib - [22892]
Details for d1zib__
PDB Entry: 1zib (more details), 2 Å
PDB Description: reduced pseudoazurin
SCOP Domain Sequences for d1zib__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zib__ b.6.1.1 (-) Pseudoazurin {Achromobacter cycloclastes}
adfevhmlnkgkdgamvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
algn
SCOP Domain Coordinates for d1zib__:
Click to download the PDB-style file with coordinates for d1zib__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zib__:
- d1zib__ first appeared (with stable ids) in SCOP 1.55
- d1zib__ appears in SCOP 1.59
- d1zib__ appears in SCOP 1.63
- d1zib__ appears in the current release, SCOPe 2.08, called d1ziba_
View in 3D