Lineage for d4c9ba2 (4c9b A:244-411)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113231Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 protein domains)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2113438Protein automated matches [190301] (5 species)
    not a true protein
  7. 2113444Species Human (Homo sapiens) [TaxId:9606] [187108] (3 PDB entries)
  8. 2113449Domain d4c9ba2: 4c9b A:244-411 [228918]
    automated match to d2j0sa2
    complexed with gol, po4

Details for d4c9ba2

PDB Entry: 4c9b (more details), 2 Å

PDB Description: crystal structure of eif4aiii-cwc22 complex
PDB Compounds: (A:) Eukaryotic initiation factor 4A-III

SCOPe Domain Sequences for d4c9ba2:

Sequence, based on SEQRES records: (download)

>d4c9ba2 c.37.1.19 (A:244-411) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deltlegikqffvavereewkfdtlcdlydtltitqavifcntkrkvdwltekmreanft
vssmhgdmpqkeresimkefrsgasrvlistdvwargldvpqvsliinydlpnnrelyih
rigrsgrygrkgvainfvknddirilrdieqyystqidempmnvadli

Sequence, based on observed residues (ATOM records): (download)

>d4c9ba2 c.37.1.19 (A:244-411) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deltlegikqffvavereewkfdtlcdlydtltitqavifcntkrkvdwltekmreanft
vssmhgdmpqkeresimkefrsgasrvlistdvwgldvpqvsliinydlpnnrelyihri
grsgrygrkgvainfvknddirilrdieqyystqidempmnvadli

SCOPe Domain Coordinates for d4c9ba2:

Click to download the PDB-style file with coordinates for d4c9ba2.
(The format of our PDB-style files is described here.)

Timeline for d4c9ba2: