Class a: All alpha proteins [46456] (289 folds) |
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) |
Family a.93.1.0: automated matches [191605] (1 protein) not a true family |
Protein automated matches [191104] (14 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [228914] (2 PDB entries) |
Domain d4c50a1: 4c50 A:25-432 [228915] automated match to d3ut2a1 complexed with act, glc, hem; mutant |
PDB Entry: 4c50 (more details), 2.5 Å
SCOPe Domain Sequences for d4c50a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c50a1 a.93.1.0 (A:25-432) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} hmkypvegggnqdwwpnrlnlkvlhqnpavadpmgaafdyaaevatidvdaltrdieevm ttsqpwwpadyghygplfirmawhaagtyrihdgrggagggmqrfaplnswpsnasldka rrllwpvkkkygkklswadlivfagncalesmgfktfgfgfgrvdqwepdevywgkeatw lgderysgkrdlenplaavqmgliyvnpegpngnpdpmaaavdiretfrrmamndvetaa livgghtfgkthgagpadlvgpepeaapleqmglgwkssygtgtgkdaitsgievvwtnt ptkwdnsfleilygyeweltkspagawqytakdgagagtipdpfggpgrsptmlatdlsl rvdpiyeritrrwlehpeeladefakawyklihrdmgpvarylgplvp
Timeline for d4c50a1: