Lineage for d4c50a1 (4c50 A:25-432)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2720706Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2720707Protein automated matches [191104] (14 species)
    not a true protein
  7. 2720819Species Mycobacterium tuberculosis [TaxId:83332] [228914] (2 PDB entries)
  8. 2720820Domain d4c50a1: 4c50 A:25-432 [228915]
    automated match to d3ut2a1
    complexed with act, glc, hem; mutant

Details for d4c50a1

PDB Entry: 4c50 (more details), 2.5 Å

PDB Description: crystal structure of the catalase-peroxidase (katg) d137s mutant from mycobacterium tuberculosis
PDB Compounds: (A:) Catalase-peroxidase

SCOPe Domain Sequences for d4c50a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c50a1 a.93.1.0 (A:25-432) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
hmkypvegggnqdwwpnrlnlkvlhqnpavadpmgaafdyaaevatidvdaltrdieevm
ttsqpwwpadyghygplfirmawhaagtyrihdgrggagggmqrfaplnswpsnasldka
rrllwpvkkkygkklswadlivfagncalesmgfktfgfgfgrvdqwepdevywgkeatw
lgderysgkrdlenplaavqmgliyvnpegpngnpdpmaaavdiretfrrmamndvetaa
livgghtfgkthgagpadlvgpepeaapleqmglgwkssygtgtgkdaitsgievvwtnt
ptkwdnsfleilygyeweltkspagawqytakdgagagtipdpfggpgrsptmlatdlsl
rvdpiyeritrrwlehpeeladefakawyklihrdmgpvarylgplvp

SCOPe Domain Coordinates for d4c50a1:

Click to download the PDB-style file with coordinates for d4c50a1.
(The format of our PDB-style files is described here.)

Timeline for d4c50a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4c50a2