SCOPe 2.06: Domain d3zptb_: 3zpt B:

Lineage for d3zptb_ (3zpt B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (11 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (25 PDB entries)

8. Domain d3zptb_: 3zpt B: [228913]
   automated match to d2wl0a_
   complexed with cl, m8y

Details for d3zptb_

PDB Entry: 3zpt, 1.54 Å

PDB Description: design and synthesis of p1-p3 macrocyclic tertiary alcohol comprising hiv-1 protease inhibitors

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d3zptb_:

Sequence; same for both SEQRES and ATOM records:

>d3zptb_ b.50.1.1 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf

Timeline for d3zptb_:

• d3zptb_ first appeared in SCOPe 2.03
  
• d3zptb_ appears in SCOPe 2.05
  
• d3zptb_ appears in SCOPe 2.07
  
• d3zptb_ appears in the current release, SCOPe 2.08