SCOPe 2.03: Domain d3zpub_: 3zpu B:

Lineage for d3zpub_ (3zpu B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (11 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (17 PDB entries)

8. Domain d3zpub_: 3zpu B: [228912]
   automated match to d2wl0a_
   complexed with cl, m8b

Details for d3zpub_

PDB Entry: 3zpu, 1.8 Å

PDB Description: design and synthesis of p1-p3 macrocyclic tertiary alcohol comprising hiv-1 protease inhibitors

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d3zpub_:

Sequence; same for both SEQRES and ATOM records:

>d3zpub_ b.50.1.1 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf

Timeline for d3zpub_:

• d3zpub_ is new in SCOPe 2.03-stable
  
• d3zpub_ appears in SCOPe 2.04
  
• d3zpub_ appears in the current release, SCOPe 2.08