Lineage for d1bqr__ (1bqr -)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 162480Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
  4. 162481Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
  5. 162482Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 162711Protein Pseudoazurin [49522] (4 species)
  7. 162712Species Achromobacter cycloclastes [TaxId:223] [49525] (4 PDB entries)
  8. 162715Domain d1bqr__: 1bqr - [22891]

Details for d1bqr__

PDB Entry: 1bqr (more details), 1.6 Å

PDB Description: reduced pseudoazurin

SCOP Domain Sequences for d1bqr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqr__ b.6.1.1 (-) Pseudoazurin {Achromobacter cycloclastes}
adfevhmlnkgkdgamvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
algn

SCOP Domain Coordinates for d1bqr__:

Click to download the PDB-style file with coordinates for d1bqr__.
(The format of our PDB-style files is described here.)

Timeline for d1bqr__: