Lineage for d1bqra_ (1bqr A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770922Protein Pseudoazurin [49522] (4 species)
  7. 2770923Species Achromobacter cycloclastes [TaxId:223] [49525] (14 PDB entries)
  8. 2770938Domain d1bqra_: 1bqr A: [22891]
    complexed with cu

Details for d1bqra_

PDB Entry: 1bqr (more details), 1.6 Å

PDB Description: reduced pseudoazurin
PDB Compounds: (A:) pseudoazurin

SCOPe Domain Sequences for d1bqra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqra_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]}
adfevhmlnkgkdgamvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
algn

SCOPe Domain Coordinates for d1bqra_:

Click to download the PDB-style file with coordinates for d1bqra_.
(The format of our PDB-style files is described here.)

Timeline for d1bqra_: