SCOPe 2.05: Domain d3zpsa_: 3zps A:

Lineage for d3zpsa_ (3zps A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (10 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (18 PDB entries)

8. Domain d3zpsa_: 3zps A: [228908]
   automated match to d2wl0a_
   complexed with cl, eqm

Details for d3zpsa_

PDB Entry: 3zps, 1.55 Å

PDB Description: design and synthesis of p1-p3 macrocyclic tertiary alcohol comprising hiv-1 protease inhibitors

PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3zpsa_:

Sequence; same for both SEQRES and ATOM records:

>d3zpsa_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf

Timeline for d3zpsa_:

• d3zpsa_ first appeared in SCOPe 2.03
  
• d3zpsa_ appears in SCOPe 2.04
  
• d3zpsa_ appears in SCOPe 2.06
  
• d3zpsa_ appears in the current release, SCOPe 2.08