Lineage for d3zpsa_ (3zps A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2391027Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 protein domains)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2392314Protein automated matches [190433] (11 species)
    not a true protein
  7. 2392358Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (25 PDB entries)
  8. 2392370Domain d3zpsa_: 3zps A: [228908]
    automated match to d2wl0a_
    complexed with cl, eqm

Details for d3zpsa_

PDB Entry: 3zps (more details), 1.55 Å

PDB Description: design and synthesis of p1-p3 macrocyclic tertiary alcohol comprising hiv-1 protease inhibitors
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3zpsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zpsa_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf

SCOPe Domain Coordinates for d3zpsa_:

Click to download the PDB-style file with coordinates for d3zpsa_.
(The format of our PDB-style files is described here.)

Timeline for d3zpsa_: