SCOPe 2.03: Domain d3zk9b_: 3zk9 B:

Lineage for d3zk9b_ (3zk9 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.2: TroA-like [53811] (6 proteins)

6. Protein automated matches [191053] (3 species)
   not a true protein

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [189842] (5 PDB entries)

8. Domain d3zk9b_: 3zk9 B: [228907]
   automated match to d3ztta_
   complexed with trs

Details for d3zk9b_

PDB Entry: 3zk9, 1.45 Å

PDB Description: crystal structure of pneumococcal surface antigen psaa d280n in the metal-free, open state

PDB Compounds: (B:) manganese abc transporter substrate-binding lipoprotein

SCOPe Domain Sequences for d3zk9b_:

Sequence; same for both SEQRES and ATOM records:

>d3zk9b_ c.92.2.2 (B:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
klkvvatnsiiaditkniagdkidlhsivpigqdpheyeplpedvkktseadlifyngin
letggnawftklvenakktenkdyfavsdgvdviylegqnekgkedphawlnlengiifa
kniakqlsakdpnnkefyeknlkeytdkldkldkeskdkfnkipaekklivtsegafkyf
skaygvpsayiweinteeegtpeqiktlveklrqtkvpslfvessvddrpmktvsqdtni
piyaqiftnsiaeqgkegdsyysmmkynldkiaeglak

Timeline for d3zk9b_:

• d3zk9b_ is new in SCOPe 2.03-stable
  
• d3zk9b_ appears in SCOPe 2.04
  
• d3zk9b_ appears in the current release, SCOPe 2.08