Lineage for d3zk7a_ (3zk7 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912356Family c.92.2.2: TroA-like [53811] (6 proteins)
  6. 2912385Protein automated matches [191053] (5 species)
    not a true protein
  7. 2912402Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [189842] (7 PDB entries)
  8. 2912411Domain d3zk7a_: 3zk7 A: [228905]
    automated match to d3ztta_
    complexed with trs

Details for d3zk7a_

PDB Entry: 3zk7 (more details), 1.69 Å

PDB Description: crystal structure of pneumococcal surface antigen psaa in the metal- free, open state
PDB Compounds: (A:) manganese abc transporter substrate-binding lipoprotein

SCOPe Domain Sequences for d3zk7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zk7a_ c.92.2.2 (A:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
klkvvatnsiiaditkniagdkidlhsivpigqdpheyeplpedvkktseadlifyngin
letggnawftklvenakktenkdyfavsdgvdviylegqnekgkedphawlnlengiifa
kniakqlsakdpnnkefyeknlkeytdkldkldkeskdkfnkipaekklivtsegafkyf
skaygvpsayiweinteeegtpeqiktlveklrqtkvpslfvessvddrpmktvsqdtni
piyaqiftdsiaeqgkegdsyysmmkynldkiaeglak

SCOPe Domain Coordinates for d3zk7a_:

Click to download the PDB-style file with coordinates for d3zk7a_.
(The format of our PDB-style files is described here.)

Timeline for d3zk7a_: