Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) contains a long alpha helical insertion in the interdomain linker |
Family c.92.2.2: TroA-like [53811] (6 proteins) |
Protein automated matches [191053] (5 species) not a true protein |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [189842] (7 PDB entries) |
Domain d3zk7a_: 3zk7 A: [228905] automated match to d3ztta_ complexed with trs |
PDB Entry: 3zk7 (more details), 1.69 Å
SCOPe Domain Sequences for d3zk7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zk7a_ c.92.2.2 (A:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} klkvvatnsiiaditkniagdkidlhsivpigqdpheyeplpedvkktseadlifyngin letggnawftklvenakktenkdyfavsdgvdviylegqnekgkedphawlnlengiifa kniakqlsakdpnnkefyeknlkeytdkldkldkeskdkfnkipaekklivtsegafkyf skaygvpsayiweinteeegtpeqiktlveklrqtkvpslfvessvddrpmktvsqdtni piyaqiftdsiaeqgkegdsyysmmkynldkiaeglak
Timeline for d3zk7a_: