Lineage for d1zia__ (1zia -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 11095Protein Pseudoazurin [49522] (4 species)
  7. 11096Species Achromobacter cycloclastes [TaxId:223] [49525] (4 PDB entries)
  8. 11098Domain d1zia__: 1zia - [22890]

Details for d1zia__

PDB Entry: 1zia (more details), 1.54 Å

PDB Description: oxidized pseudoazurin

SCOP Domain Sequences for d1zia__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zia__ b.6.1.1 (-) Pseudoazurin {Achromobacter cycloclastes}
adfevhmlnkgkdgamvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
algn

SCOP Domain Coordinates for d1zia__:

Click to download the PDB-style file with coordinates for d1zia__.
(The format of our PDB-style files is described here.)

Timeline for d1zia__: