Lineage for d3w0tc_ (3w0t C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942378Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (2 proteins)
    duplication: consists of two clear structural repeats each having this fold
  6. 2942408Protein automated matches [190953] (2 species)
    not a true protein
  7. 2942409Species Human (Homo sapiens) [TaxId:9606] [193319] (3 PDB entries)
  8. 2942414Domain d3w0tc_: 3w0t C: [228897]
    automated match to d3vw9b_
    complexed with epe, hpu, zn

Details for d3w0tc_

PDB Entry: 3w0t (more details), 1.35 Å

PDB Description: Human Glyoxalase I with an N-hydroxypyridone derivative inhibitor
PDB Compounds: (C:) lactoylglutathione lyase

SCOPe Domain Sequences for d3w0tc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w0tc_ d.32.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggltdeaalsccsdadpstkdfllqqtmlrvkdpkksldfytrvlgmtliqkcdfpimkf
slyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhngnsdprgfghi
giavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywieilnpnkmatlm

SCOPe Domain Coordinates for d3w0tc_:

Click to download the PDB-style file with coordinates for d3w0tc_.
(The format of our PDB-style files is described here.)

Timeline for d3w0tc_: