SCOPe 2.05: Domain d3w0tb_: 3w0t B:

Lineage for d3w0tb_ (3w0t B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (2 proteins)
   duplication: consists of two clear structural repeats each having this fold

6. Protein automated matches [190953] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193319] (3 PDB entries)

8. Domain d3w0tb_: 3w0t B: [228896]
   automated match to d3vw9b_
   complexed with epe, hpu, zn

Details for d3w0tb_

PDB Entry: 3w0t, 1.35 Å

PDB Description: Human Glyoxalase I with an N-hydroxypyridone derivative inhibitor

PDB Compounds: (B:) lactoylglutathione lyase

SCOPe Domain Sequences for d3w0tb_:

Sequence; same for both SEQRES and ATOM records:

>d3w0tb_ d.32.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epqppsggltdeaalsccsdadpstkdfllqqtmlrvkdpkksldfytrvlgmtliqkcd
fpimkfslyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhngnsdp
rgfghigiavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywieilnpnkmat
lm

Timeline for d3w0tb_:

• d3w0tb_ first appeared in SCOPe 2.03
  
• d3w0tb_ appears in SCOPe 2.04
  
• d3w0tb_ appears in SCOPe 2.06
  
• d3w0tb_ appears in the current release, SCOPe 2.08