Lineage for d3w0ua_ (3w0u A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1900809Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1900810Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 1900811Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (2 proteins)
    duplication: consists of two clear structural repeats each having this fold
  6. 1900841Protein automated matches [190953] (2 species)
    not a true protein
  7. 1900842Species Human (Homo sapiens) [TaxId:9606] [193319] (3 PDB entries)
  8. 1900849Domain d3w0ua_: 3w0u A: [228893]
    automated match to d3vw9b_
    complexed with hpw, zn

Details for d3w0ua_

PDB Entry: 3w0u (more details), 1.7 Å

PDB Description: human Glyoxalase I with an N-hydroxypyridone inhibitor
PDB Compounds: (A:) lactoylglutathione lyase

SCOPe Domain Sequences for d3w0ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w0ua_ d.32.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggltdeaalsccsdadpstkdfllqqtmlrvkdpkksldfytrvlgmtliqkcdfpimkf
slyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhngnsdprgfghi
giavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywieilnpnkmatl

SCOPe Domain Coordinates for d3w0ua_:

Click to download the PDB-style file with coordinates for d3w0ua_.
(The format of our PDB-style files is described here.)

Timeline for d3w0ua_: