SCOPe 2.07: Domain d4ovja_: 4ovj A:

Lineage for d4ovja_ (4ovj A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (146 species)
   not a true protein

7. Species Alicyclobacillus acidocaldarius [TaxId:521098] [228890] (1 PDB entry)

8. Domain d4ovja_: 4ovj A: [228891]
   automated match to d1eu8a_
   complexed with so4

Details for d4ovja_

PDB Entry: 4ovj, 1.65 Å

PDB Description: extracellular solute-binding protein family 1 from alicyclobacillus acidocaldarius subsp. acidocaldarius dsm 446

PDB Compounds: (A:) Extracellular solute-binding protein family 1

SCOPe Domain Sequences for d4ovja_:

Sequence; same for both SEQRES and ATOM records:

>d4ovja_ c.94.1.0 (A:) automated matches {Alicyclobacillus acidocaldarius [TaxId: 521098]}
dskpvvtltfgfwgdakeeavtlaavkafekaypnihiqtefggpfnqyftklstevagg
napdimqmdyeyidayakegqllnlkgakginistispsvlksgyidgglygipnalnny
aviydeaafakagyhgqrvswqqwadilekvhkatgkwaenddeswqtfgywarqhgqhl
ynasgtklgftestlvsylnywanlrkegvvppgtvtslikqtadptdpmvqgksdaelt
wvnyvvslqsemtrslalalpptqpggeeglyikpsqfwsiysktkypqqaelfvnflln
nvqagkalglvrgipvsssvrtqlmasgtsapekaefqlvnealkvatpidppppqhdke
idqdfanmvqavqygketpqqgaeqfmqeandllqn

Timeline for d4ovja_:

• d4ovja_ first appeared in SCOPe 2.03
  
• d4ovja_ appears in SCOPe 2.06