Lineage for d4ovja_ (4ovj A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915239Species Alicyclobacillus acidocaldarius [TaxId:521098] [228890] (1 PDB entry)
  8. 2915240Domain d4ovja_: 4ovj A: [228891]
    automated match to d1eu8a_
    complexed with so4

Details for d4ovja_

PDB Entry: 4ovj (more details), 1.65 Å

PDB Description: extracellular solute-binding protein family 1 from alicyclobacillus acidocaldarius subsp. acidocaldarius dsm 446
PDB Compounds: (A:) Extracellular solute-binding protein family 1

SCOPe Domain Sequences for d4ovja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ovja_ c.94.1.0 (A:) automated matches {Alicyclobacillus acidocaldarius [TaxId: 521098]}
dskpvvtltfgfwgdakeeavtlaavkafekaypnihiqtefggpfnqyftklstevagg
napdimqmdyeyidayakegqllnlkgakginistispsvlksgyidgglygipnalnny
aviydeaafakagyhgqrvswqqwadilekvhkatgkwaenddeswqtfgywarqhgqhl
ynasgtklgftestlvsylnywanlrkegvvppgtvtslikqtadptdpmvqgksdaelt
wvnyvvslqsemtrslalalpptqpggeeglyikpsqfwsiysktkypqqaelfvnflln
nvqagkalglvrgipvsssvrtqlmasgtsapekaefqlvnealkvatpidppppqhdke
idqdfanmvqavqygketpqqgaeqfmqeandllqn

SCOPe Domain Coordinates for d4ovja_:

Click to download the PDB-style file with coordinates for d4ovja_.
(The format of our PDB-style files is described here.)

Timeline for d4ovja_: