Lineage for d4nc5a1 (4nc5 A:4-378)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2398194Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2398195Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2398492Protein automated matches [193245] (14 species)
    not a true protein
  7. 2398493Species Human (Homo sapiens) [TaxId:9606] [228885] (2 PDB entries)
  8. 2398495Domain d4nc5a1: 4nc5 A:4-378 [228886]
    Other proteins in same PDB: d4nc5a2
    automated match to d1vcua_
    complexed with fsi, po4

Details for d4nc5a1

PDB Entry: 4nc5 (more details), 2.51 Å

PDB Description: human sialidase 2 in complex with 2,3-difluorosialic acid (covalent intermediate)
PDB Compounds: (A:) Sialidase-2

SCOPe Domain Sequences for d4nc5a1:

Sequence, based on SEQRES records: (download)

>d4nc5a1 b.68.1.1 (A:4-378) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpvlqkesvfqsgahayripallylpgqqsllafaeqraskkaehaelivlrrgdydapt
hqvqwqaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvteqqqlqtranvtr
lcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpayayrk
lhpiqrpipsafcflshdhgrtwarghfvaqdtlecqvaevetgeqrvvtlnarshlrar
vqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprsgpgspaqwllythpthswq
radlgaylnprppapeawsepvllakgscaysdlqsmgtgpdgsplfgclyeandyeeiv
flmftlkqafpaeyl

Sequence, based on observed residues (ATOM records): (download)

>d4nc5a1 b.68.1.1 (A:4-378) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpvlqkesvfqsgahayripallylpgqqsllafaeqraaelivlrrgdydapthqvqwq
aqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvranvtrlcqvtstdhgrtws
sprdltdaaigpayrewstfavgpghclqlndrarslvvpayayrklhpiqrpipsafcf
lshdhgrtwarghfvaqdtlecqvaevetqrvvtlnarshlrarvqaqstndgldfqesq
lvkklvepppqgcqgsvisfpspraqwllythpthswqradlgaylnprppapeawsepv
llakgscaysdlqsmgtgpdgsplfgclyeandyeeivflmftlkqafpaeyl

SCOPe Domain Coordinates for d4nc5a1:

Click to download the PDB-style file with coordinates for d4nc5a1.
(The format of our PDB-style files is described here.)

Timeline for d4nc5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4nc5a2