SCOPe 2.06: Domain d4naxa2: 4nax A:104-231

Lineage for d4naxa2 (4nax A:104-231)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (61 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:351746] [228881] (1 PDB entry)

8. Domain d4naxa2: 4nax A:104-231 [228882]
   Other proteins in same PDB: d4naxa1, d4naxa3, d4naxb1
   automated match to d4ikha2
   complexed with fmt, gds, gol

Details for d4naxa2

PDB Entry: 4nax, 1.3 Å

PDB Description: crystal structure of glutathione transferase pput_1760 from pseudomonas putida, target efi-507288, with one glutathione disulfide bound per one protein subunit

PDB Compounds: (A:) Glutathione S-transferase, N-terminal domain protein

SCOPe Domain Sequences for d4naxa2:

Sequence; same for both SEQRES and ATOM records:

>d4naxa2 a.45.1.0 (A:104-231) automated matches {Pseudomonas putida [TaxId: 351746]}
llsqdpaqryqtlqwlmfqmggigpmfgqvgffhffagkeyedkrprdryvneskrllgv
ldrhlkgrqwmaeeysiadiaifpwvrnlverynardlvgfdqfkevqrvlanflerpav
qhglkipg

Timeline for d4naxa2:

• d4naxa2 first appeared in SCOPe 2.03
  
• d4naxa2 appears in SCOPe 2.05
  
• d4naxa2 appears in SCOPe 2.07
  
• d4naxa2 appears in the current release, SCOPe 2.08