Lineage for d4naxa2 (4nax A:104-231)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714178Species Pseudomonas putida [TaxId:351746] [228881] (1 PDB entry)
  8. 2714179Domain d4naxa2: 4nax A:104-231 [228882]
    Other proteins in same PDB: d4naxa1, d4naxa3, d4naxb1
    automated match to d4ikha2
    complexed with fmt, gds, gol

Details for d4naxa2

PDB Entry: 4nax (more details), 1.3 Å

PDB Description: crystal structure of glutathione transferase pput_1760 from pseudomonas putida, target efi-507288, with one glutathione disulfide bound per one protein subunit
PDB Compounds: (A:) Glutathione S-transferase, N-terminal domain protein

SCOPe Domain Sequences for d4naxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4naxa2 a.45.1.0 (A:104-231) automated matches {Pseudomonas putida [TaxId: 351746]}
llsqdpaqryqtlqwlmfqmggigpmfgqvgffhffagkeyedkrprdryvneskrllgv
ldrhlkgrqwmaeeysiadiaifpwvrnlverynardlvgfdqfkevqrvlanflerpav
qhglkipg

SCOPe Domain Coordinates for d4naxa2:

Click to download the PDB-style file with coordinates for d4naxa2.
(The format of our PDB-style files is described here.)

Timeline for d4naxa2: