![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Pseudomonas putida [TaxId:351746] [228881] (1 PDB entry) |
![]() | Domain d4naxa2: 4nax A:104-231 [228882] Other proteins in same PDB: d4naxa1, d4naxa3, d4naxb1 automated match to d4ikha2 complexed with fmt, gds, gol |
PDB Entry: 4nax (more details), 1.3 Å
SCOPe Domain Sequences for d4naxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4naxa2 a.45.1.0 (A:104-231) automated matches {Pseudomonas putida [TaxId: 351746]} llsqdpaqryqtlqwlmfqmggigpmfgqvgffhffagkeyedkrprdryvneskrllgv ldrhlkgrqwmaeeysiadiaifpwvrnlverynardlvgfdqfkevqrvlanflerpav qhglkipg
Timeline for d4naxa2: