Lineage for d1pmy__ (1pmy -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins) 
Protein Pseudoazurin [49522] (4 species) 
Species Methylobacterium extorquens, strain am1 [TaxId:408] [49524] (1 PDB entry) 
Domain d1pmy__: 1pmy - [22888]
Details for d1pmy__
PDB Entry: 1pmy (more details), 1.5 Å
PDB Description: refined crystal structure of pseudoazurin from methylobacterium extorquens am1 at 1.5 angstroms resolution
SCOP Domain Sequences for d1pmy__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pmy__ b.6.1.1 (-) Pseudoazurin {Methylobacterium extorquens, strain am1}
devavkmlnsgpggmmvfdpalvrlkpgdsikflptdkghnvetikgmapdgadyvkttv
gqeavvkfdkegvygfkcaphymmgmvalvvvgdkrdnleaaksvqhnkltqkrldplfa
qiq
SCOP Domain Coordinates for d1pmy__:
Click to download the PDB-style file with coordinates for d1pmy__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pmy__:
- d1pmy__ appears in SCOP 1.57
- d1pmy__ appears in the current release, SCOPe 2.08, called d1pmya_
View in 3D