Lineage for d1pmy__ (1pmy -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 11095Protein Pseudoazurin [49522] (4 species)
  7. 11112Species Methylobacterium extorquens, strain am1 [TaxId:408] [49524] (1 PDB entry)
  8. 11113Domain d1pmy__: 1pmy - [22888]

Details for d1pmy__

PDB Entry: 1pmy (more details), 1.5 Å

PDB Description: refined crystal structure of pseudoazurin from methylobacterium extorquens am1 at 1.5 angstroms resolution

SCOP Domain Sequences for d1pmy__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmy__ b.6.1.1 (-) Pseudoazurin {Methylobacterium extorquens, strain am1}
devavkmlnsgpggmmvfdpalvrlkpgdsikflptdkghnvetikgmapdgadyvkttv
gqeavvkfdkegvygfkcaphymmgmvalvvvgdkrdnleaaksvqhnkltqkrldplfa
qiq

SCOP Domain Coordinates for d1pmy__:

Click to download the PDB-style file with coordinates for d1pmy__.
(The format of our PDB-style files is described here.)

Timeline for d1pmy__: