![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein Pseudoazurin [49522] (4 species) |
![]() | Species Methylobacterium extorquens, strain am1 [TaxId:408] [49524] (1 PDB entry) |
![]() | Domain d1pmya_: 1pmy A: [22888] complexed with cu |
PDB Entry: 1pmy (more details), 1.5 Å
SCOPe Domain Sequences for d1pmya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} devavkmlnsgpggmmvfdpalvrlkpgdsikflptdkghnvetikgmapdgadyvkttv gqeavvkfdkegvygfkcaphymmgmvalvvvgdkrdnleaaksvqhnkltqkrldplfa qiq
Timeline for d1pmya_: