Lineage for d1pmya_ (1pmy A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770922Protein Pseudoazurin [49522] (4 species)
  7. 2770965Species Methylobacterium extorquens, strain am1 [TaxId:408] [49524] (1 PDB entry)
  8. 2770966Domain d1pmya_: 1pmy A: [22888]
    complexed with cu

Details for d1pmya_

PDB Entry: 1pmy (more details), 1.5 Å

PDB Description: refined crystal structure of pseudoazurin from methylobacterium extorquens am1 at 1.5 angstroms resolution
PDB Compounds: (A:) pseudoazurin

SCOPe Domain Sequences for d1pmya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]}
devavkmlnsgpggmmvfdpalvrlkpgdsikflptdkghnvetikgmapdgadyvkttv
gqeavvkfdkegvygfkcaphymmgmvalvvvgdkrdnleaaksvqhnkltqkrldplfa
qiq

SCOPe Domain Coordinates for d1pmya_:

Click to download the PDB-style file with coordinates for d1pmya_.
(The format of our PDB-style files is described here.)

Timeline for d1pmya_: