Lineage for d4nawm_ (4naw M:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2540226Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2540227Protein automated matches [190233] (31 species)
    not a true protein
  7. 2540283Species Human (Homo sapiens) [TaxId:9606] [187090] (152 PDB entries)
  8. 2540398Domain d4nawm_: 4naw M: [228877]
    automated match to d4gdla_
    complexed with na, so4

Details for d4nawm_

PDB Entry: 4naw (more details), 2.2 Å

PDB Description: crystal structure of human atg12~atg5-atg16n in complex with a fragment of atg3
PDB Compounds: (M:) Ubiquitin-like protein ATG12

SCOPe Domain Sequences for d4nawm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nawm_ d.15.1.0 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkidillkavgdtpimktkkwavertrtiqglidfikkflklvaseqlfiyvnqsfapsp
dqevgtlyecfgsdgklvlhycksqawg

SCOPe Domain Coordinates for d4nawm_:

Click to download the PDB-style file with coordinates for d4nawm_.
(The format of our PDB-style files is described here.)

Timeline for d4nawm_: