Lineage for d4nawe_ (4naw E:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1893753Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 1893754Protein automated matches [190233] (11 species)
    not a true protein
  7. 1893780Species Human (Homo sapiens) [TaxId:9606] [187090] (45 PDB entries)
  8. 1893798Domain d4nawe_: 4naw E: [228875]
    automated match to d4gdla_
    complexed with na, so4

Details for d4nawe_

PDB Entry: 4naw (more details), 2.19 Å

PDB Description: crystal structure of human atg12~atg5-atg16n in complex with a fragment of atg3
PDB Compounds: (E:) Ubiquitin-like protein ATG12

SCOPe Domain Sequences for d4nawe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nawe_ d.15.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkidillkavgdtpimktkkwavertrtiqglidfikkflklvaseqlfiyvnqsfapsp
dqevgtlyecfgsdgklvlhycksqawg

SCOPe Domain Coordinates for d4nawe_:

Click to download the PDB-style file with coordinates for d4nawe_.
(The format of our PDB-style files is described here.)

Timeline for d4nawe_: