Lineage for d1pzc__ (1pzc -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (4 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins) 
Protein Pseudoazurin [49522] (4 species) 
Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49523] (10 PDB entries) 
Domain d1pzc__: 1pzc - [22885]
Details for d1pzc__
PDB Entry: 1pzc (more details), 1.85 Å
PDB Description: apo-pseudoazurin (metal free protein)
SCOP Domain Sequences for d1pzc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pzc__ b.6.1.1 (-) Pseudoazurin {Alcaligenes faecalis, strain s-6}
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia
sa
SCOP Domain Coordinates for d1pzc__:
Click to download the PDB-style file with coordinates for d1pzc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pzc__:
- d1pzc__ first appeared (with stable ids) in SCOP 1.55
- d1pzc__ appears in SCOP 1.57
- d1pzc__ appears in SCOP 1.61
- d1pzc__ appears in the current release, SCOPe 2.08, called d1pzca_
View in 3D