Lineage for d1pzc__ (1pzc -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 11095Protein Pseudoazurin [49522] (4 species)
  7. 11101Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49523] (10 PDB entries)
  8. 11109Domain d1pzc__: 1pzc - [22885]

Details for d1pzc__

PDB Entry: 1pzc (more details), 1.85 Å

PDB Description: apo-pseudoazurin (metal free protein)

SCOP Domain Sequences for d1pzc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzc__ b.6.1.1 (-) Pseudoazurin {Alcaligenes faecalis, strain s-6}
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia
sa

SCOP Domain Coordinates for d1pzc__:

Click to download the PDB-style file with coordinates for d1pzc__.
(The format of our PDB-style files is described here.)

Timeline for d1pzc__: