Lineage for d1pza__ (1pza -)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106628Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 106629Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 106630Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 106854Protein Pseudoazurin [49522] (4 species)
  7. 106860Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49523] (10 PDB entries)
  8. 106867Domain d1pza__: 1pza - [22884]

Details for d1pza__

PDB Entry: 1pza (more details), 1.8 Å

PDB Description: the crystal structures of reduced pseudoazurin from alcaligenes faecalis s-6 at two ph values

SCOP Domain Sequences for d1pza__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pza__ b.6.1.1 (-) Pseudoazurin {Alcaligenes faecalis, strain s-6}
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia

SCOP Domain Coordinates for d1pza__:

Click to download the PDB-style file with coordinates for d1pza__.
(The format of our PDB-style files is described here.)

Timeline for d1pza__: