Lineage for d4n95b1 (4n95 B:1-122)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2215792Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2215793Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2215794Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
    duplication: consists of three domains of this fold
  6. 2215795Protein DNA polymerase III, beta subunit [55981] (2 species)
  7. 2215796Species Escherichia coli [TaxId:562] [55982] (30 PDB entries)
    Uniprot P00583
  8. 2215860Domain d4n95b1: 4n95 B:1-122 [228836]
    automated match to d3d1ga1
    complexed with 2hq, ca, cl, peg, pg4, pge

Details for d4n95b1

PDB Entry: 4n95 (more details), 1.8 Å

PDB Description: E. coli sliding clamp in complex with 5-chloroindoline-2,3-dione
PDB Compounds: (B:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d4n95b1:

Sequence, based on SEQRES records: (download)

>d4n95b1 d.131.1.1 (B:1-122) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]}
mkftverehllkplqqvsgplggrptlpilgnlllqvadgtlsltgtdlememvarvalv
qphepgattvparkffdicrglpegaeiavqlegermlvrsgrsrfslstlpaadfpnld
dw

Sequence, based on observed residues (ATOM records): (download)

>d4n95b1 d.131.1.1 (B:1-122) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]}
mkftverehllkplqqvsgplptlpilgnlllqvadgtlsltgtdlememvarvalvqph
epgattvparkffdicrglpegaeiavqlegermlvrsgrsrfslstlpaadfpnlddw

SCOPe Domain Coordinates for d4n95b1:

Click to download the PDB-style file with coordinates for d4n95b1.
(The format of our PDB-style files is described here.)

Timeline for d4n95b1: