Lineage for d1pzb__ (1pzb -)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 162480Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
  4. 162481Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
  5. 162482Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 162711Protein Pseudoazurin [49522] (4 species)
  7. 162717Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49523] (10 PDB entries)
  8. 162723Domain d1pzb__: 1pzb - [22883]

Details for d1pzb__

PDB Entry: 1pzb (more details), 1.8 Å

PDB Description: the crystal structures of reduced pseudoazurin from alcaligenes faecalis s-6 at two ph values

SCOP Domain Sequences for d1pzb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzb__ b.6.1.1 (-) Pseudoazurin {Alcaligenes faecalis, strain s-6}
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia

SCOP Domain Coordinates for d1pzb__:

Click to download the PDB-style file with coordinates for d1pzb__.
(The format of our PDB-style files is described here.)

Timeline for d1pzb__: