Lineage for d4n7tb1 (4n7t B:3-107,B:227-403)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138453Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2138454Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2138617Family c.76.1.5: DeoB catalytic domain-like [142735] (1 protein)
    Pfam PF08342 in the N-terminal part; Pfam PF01676 in the C-terminal part; there is an alpha+beta domain between the two parts, inserted in the same location as the substrate-binding domain of 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase
  6. 2138618Protein Phosphopentomutase DeoB [142736] (1 species)
  7. 2138619Species Streptococcus mutans [TaxId:1309] [142737] (2 PDB entries)
    Uniprot Q8DTU0 2-107,227-403
  8. 2138623Domain d4n7tb1: 4n7t B:3-107,B:227-403 [228829]
    Other proteins in same PDB: d4n7ta2, d4n7tb2
    automated match to d3m7va1
    complexed with azi, gol, mn, peg, so4

Details for d4n7tb1

PDB Entry: 4n7t (more details), 2 Å

PDB Description: Crystal structure of phosphorylated phosphopentomutase from streptococcus mutans
PDB Compounds: (B:) Phosphopentomutase

SCOPe Domain Sequences for d4n7tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n7tb1 c.76.1.5 (B:3-107,B:227-403) Phosphopentomutase DeoB {Streptococcus mutans [TaxId: 1309]}
tfnrihlvvldsvgigaapdannfsnagvpdgasdtlghisktvglnvpnmakiglgnip
rdtplktvpaenhptgyvtkleevslgkdtmtghweimglnitepXspfaptvlnklada
gvstyavgkindifngsgitndmghnksnshgvdtliktmglsaftkgfsftnlvdfdal
yghrrnahgyrdclhefderlpeiiaamkvddlllitadhgndptyagtdhtreyvplla
yspsftgngvlpvghyadisatiadnfgvdtamigesfldkli

SCOPe Domain Coordinates for d4n7tb1:

Click to download the PDB-style file with coordinates for d4n7tb1.
(The format of our PDB-style files is described here.)

Timeline for d4n7tb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4n7tb2