SCOPe 2.05: Domain d4n4cb_: 4n4c B:

Lineage for d4n4cb_ (4n4c B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Seminal ribonucleasease [54086] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54087] (17 PDB entries)
   Uniprot P00669 27-150

8. Domain d4n4cb_: 4n4c B: [228827]
   automated match to d1y94a_
   complexed with po4; mutant

Details for d4n4cb_

PDB Entry: 4n4c, 2.48 Å

PDB Description: Crystal structure of the C-terminal swapped dimer of a Bovine seminal ribonuclease mutant

PDB Compounds: (B:) Seminal ribonuclease

SCOPe Domain Sequences for d4n4cb_:

Sequence; same for both SEQRES and ATOM records:

>d4n4cb_ d.5.1.1 (B:) Seminal ribonucleasease {Cow (Bos taurus) [TaxId: 9913]}
kesaaakferqhmdsstsaasssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv

Timeline for d4n4cb_:

• d4n4cb_ first appeared in SCOPe 2.03
  
• d4n4cb_ appears in SCOPe 2.04
  
• d4n4cb_ appears in SCOPe 2.06
  
• d4n4cb_ appears in the current release, SCOPe 2.08