Lineage for d5paz__ (5paz -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (4 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins) 
Protein Pseudoazurin [49522] (4 species) 
Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49523] (10 PDB entries) 
Domain d5paz__: 5paz - [22882]
Details for d5paz__
PDB Entry: 5paz (more details), 1.76 Å
PDB Description: reduced mutant p80a pseudoazurin from a. faecalis
SCOP Domain Sequences for d5paz__:
Sequence; same for both SEQRES and ATOM records: (download)
>d5paz__ b.6.1.1 (-) Pseudoazurin {Alcaligenes faecalis, strain s-6}
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
nenyvltvtqpgaylvkctahyamgmialiavgdspanldqivsakkpkivqerlekvia
sak
SCOP Domain Coordinates for d5paz__:
Click to download the PDB-style file with coordinates for d5paz__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5paz__:
- d5paz__ first appeared (with stable ids) in SCOP 1.55
- d5paz__ appears in SCOP 1.57
- d5paz__ appears in SCOP 1.61
- d5paz__ appears in the current release, SCOPe 2.08, called d5paza_
View in 3D