SCOPe 2.06: Domain d4m5yl1: 4m5y L:1-106A

Lineage for d4m5yl1 (4m5y L:1-106A)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4m5yl1: 4m5y L:1-106A [228818]
   automated match to d1yuha1
   complexed with peg, pg4

Details for d4m5yl1

PDB Entry: 4m5y, 1.55 Å

PDB Description: Crystal structure of broadly neutralizing Fab 5J8

PDB Compounds: (L:) Fab 5J8 light chain

SCOPe Domain Sequences for d4m5yl1:

Sequence; same for both SEQRES and ATOM records:

>d4m5yl1 b.1.1.0 (L:1-106A) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syvltqppsvsvapgetariscggnnigtkvlhwyqqtpgqapvlvvyddsdrpsgiper
fsgsnsgntatltisrvevgdeadyycqvwdistdqavfgggtkltvl

Timeline for d4m5yl1:

• d4m5yl1 first appeared in SCOPe 2.03
  
• d4m5yl1 appears in SCOPe 2.05
  
• d4m5yl1 appears in SCOPe 2.07
  
• d4m5yl1 appears in the current release, SCOPe 2.08