Lineage for d4mzab_ (4mza B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2398194Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2398195Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2398492Protein automated matches [193245] (14 species)
    not a true protein
  7. 2398496Species Human parainfluenza 3 virus [TaxId:11217] [228816] (2 PDB entries)
  8. 2398498Domain d4mzab_: 4mza B: [228817]
    automated match to d1v3ea_
    complexed with bma, ca, edo, ful, man, nag, po4, so4

Details for d4mzab_

PDB Entry: 4mza (more details), 1.65 Å

PDB Description: crystal structure of hpiv3 hemagglutinin-neuraminidase
PDB Compounds: (B:) hemagglutinin-neuraminidase

SCOPe Domain Sequences for d4mzab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mzab_ b.68.1.1 (B:) automated matches {Human parainfluenza 3 virus [TaxId: 11217]}
evppqrithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtps
lvindliyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrks
cslallntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpy
aalypsvgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdr
rmvnsiivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlg
iiditdysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvi
ldsqksrvnpvityststervnelairnktlsagytttscithynkgycfhiveinhksl
dtfqpmlfkteipkscs

SCOPe Domain Coordinates for d4mzab_:

Click to download the PDB-style file with coordinates for d4mzab_.
(The format of our PDB-style files is described here.)

Timeline for d4mzab_: