Lineage for d4m4ye_ (4m4y E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1305718Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1305719Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1305764Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1305765Protein Hemagglutinin [49824] (6 species)
    includes rudiment esterase domain
  7. 1305775Species Influenza A virus, different strains [TaxId:11320] [49825] (86 PDB entries)
  8. 1305827Domain d4m4ye_: 4m4y E: [228803]
    automated match to d1rvxa_
    complexed with nag; mutant

Details for d4m4ye_

PDB Entry: 4m4y (more details), 2.2 Å

PDB Description: Crystal structure of a 2009 H1N1 influenza virus hemagglutinin with a stabilization mutation HA2 E47G
PDB Compounds: (E:) Hemagglutinin HA1 subunit

SCOPe Domain Sequences for d4m4ye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m4ye_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dpgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcni
agwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeif
pktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlw
gihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepg
dkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihp
itigkcpkyvkstklrlatglrnips

SCOPe Domain Coordinates for d4m4ye_:

Click to download the PDB-style file with coordinates for d4m4ye_.
(The format of our PDB-style files is described here.)

Timeline for d4m4ye_:

  • d4m4ye_ appears in periodic updates to SCOPe 2.03 starting on 2013-12-06
  • d4m4ye_ appears in SCOPe 2.04
  • d4m4ye_ appears in the current release, SCOPe 2.07, called d4m4ye1