| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243 can form strand-exchange dimers |
Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) ![]() |
| Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins) |
| Protein automated matches [227065] (3 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [228797] (1 PDB entry) |
| Domain d4lpad1: 4lpa D:7-113 [228798] Other proteins in same PDB: d4lpaa2, d4lpab2, d4lpac2, d4lpad2 automated match to d1qb3a_ |
PDB Entry: 4lpa (more details), 2.9 Å
SCOPe Domain Sequences for d4lpad1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lpad1 d.97.1.1 (D:7-113) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
afqgrkltdqerarvlefqdsihysprysddnyeyrhvmlpkamlkvipsdyfnsevgtl
riltedewrglgitqslgwehyechapephillfkrplnyeaelraa
Timeline for d4lpad1: