Lineage for d4lkia_ (4lki A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040896Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2040897Protein automated matches [227017] (33 species)
    not a true protein
  7. 2040964Species Influenza A virus [TaxId:11320] [228462] (22 PDB entries)
  8. 2040988Domain d4lkia_: 4lki A: [228795]
    Other proteins in same PDB: d4lkib_
    automated match to d1rvxa_
    complexed with nag; mutant

Details for d4lkia_

PDB Entry: 4lki (more details), 2.7 Å

PDB Description: The structure of hemagglutinin L226Q mutant from a avian-origin H7N9 influenza virus (A/Anhui/1/2013)
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4lkia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lkia_ b.19.1.0 (A:) automated matches {Influenza A virus [TaxId: 11320]}
iclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgtitg
ppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgirt
ngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvstaeq
tklygsgnklvtvgssnyqqsfvpspgarpqvngqsgridfhwlmlnpndtvtfsfngaf
iapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryvkq
rslllatgmknvpe

SCOPe Domain Coordinates for d4lkia_:

Click to download the PDB-style file with coordinates for d4lkia_.
(The format of our PDB-style files is described here.)

Timeline for d4lkia_: