Lineage for d4l6tb1 (4l6t B:22-125)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2058420Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2058912Protein automated matches [190381] (8 species)
    not a true protein
  7. 2058935Species Escherichia coli [TaxId:562] [187229] (7 PDB entries)
  8. 2058976Domain d4l6tb1: 4l6t B:22-125 [228793]
    Other proteins in same PDB: d4l6tb2, d4l6tc2, d4l6td2, d4l6te2, d4l6tf2
    automated match to d1jr0d_
    complexed with zn

Details for d4l6tb1

PDB Entry: 4l6t (more details), 1.86 Å

PDB Description: gm1 bound form of the ecx ab5 holotoxin
PDB Compounds: (B:) ecxb

SCOPe Domain Sequences for d4l6tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l6tb1 b.40.2.1 (B:22-125) automated matches {Escherichia coli [TaxId: 562]}
mtpqnitdlcneyqntmiyslnkeiatyteslagkremviisfsngatfqvevpgsqhle
sqkrplermkdtlraayftgikisklcawtnkspnsiaaielsn

SCOPe Domain Coordinates for d4l6tb1:

Click to download the PDB-style file with coordinates for d4l6tb1.
(The format of our PDB-style files is described here.)

Timeline for d4l6tb1: