Lineage for d8paz__ (8paz -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 11095Protein Pseudoazurin [49522] (4 species)
  7. 11101Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49523] (10 PDB entries)
  8. 11103Domain d8paz__: 8paz - [22879]

Details for d8paz__

PDB Entry: 8paz (more details), 1.6 Å

PDB Description: oxidized native pseudoazurin from a. faecalis

SCOP Domain Sequences for d8paz__:

Sequence; same for both SEQRES and ATOM records: (download)

>d8paz__ b.6.1.1 (-) Pseudoazurin {Alcaligenes faecalis, strain s-6}
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia
sak

SCOP Domain Coordinates for d8paz__:

Click to download the PDB-style file with coordinates for d8paz__.
(The format of our PDB-style files is described here.)

Timeline for d8paz__: