SCOPe 2.03: Domain d4knmb_: 4knm B:

Lineage for d4knmb_ (4knm B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein automated matches [190681] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187805] (14 PDB entries)

8. Domain d4knmb_: 4knm B: [228779]
   automated match to d4hu1a_
   complexed with e1e, pge, zn

Details for d4knmb_

PDB Entry: 4knm, 1.9 Å

PDB Description: Crystal structure of human carbonic anhydrase isozyme XIII with 2-Chloro-4-{[(4,6-dimethylpyrimidin-2-yl)sulfanyl]acetyl}benzenesulfonamide

PDB Compounds: (B:) Carbonic anhydrase 13

SCOPe Domain Sequences for d4knmb_:

Sequence; same for both SEQRES and ATOM records:

>d4knmb_ b.74.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisnsg
hsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvvhw
nsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdlls
llppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaaflvs
nhrppqplkgrkvrasfh

Timeline for d4knmb_:

• d4knmb_ is new in SCOPe 2.03-stable
  
• d4knmb_ appears in SCOPe 2.04
  
• d4knmb_ appears in the current release, SCOPe 2.08