SCOPe 2.03: Domain d4ij3b2: 4ij3 B:108-214

Lineage for d4ij3b2 (4ij3 B:108-214)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [227304] (35 PDB entries)

8. Domain d4ij3b2: 4ij3 B:108-214 [228774]
   automated match to d1g9ml2
   complexed with po4

Details for d4ij3b2

PDB Entry: 4ij3, 2.7 Å

PDB Description: oxidoreductase fragment of human qsox1 in complex with a fab fragment from an anti- human qsox1 antibody

PDB Compounds: (B:) light chain of Fab fragment

SCOPe Domain Sequences for d4ij3b2:

Sequence; same for both SEQRES and ATOM records:

>d4ij3b2 b.1.1.0 (B:108-214) automated matches {Mus musculus [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d4ij3b2:

• d4ij3b2 is new in SCOPe 2.03-stable
  
• d4ij3b2 appears in SCOPe 2.04
  
• d4ij3b2 appears in the current release, SCOPe 2.08