Lineage for d4hzza_ (4hzz A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2398194Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2398637Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2398638Protein automated matches [190692] (14 species)
    not a true protein
  7. 2398698Species Influenza A virus, different strains [TaxId:11320] [188445] (31 PDB entries)
  8. 2398701Domain d4hzza_: 4hzz A: [228762]
    automated match to d2htva_
    complexed with ca, g39

Details for d4hzza_

PDB Entry: 4hzz (more details), 1.6 Å

PDB Description: Crystal structure of influenza neuraminidase N3-H274Y complexed with oseltamivir
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d4hzza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hzza_ b.68.1.0 (A:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
rpfksplplcpfrgffpfhkdnairlgenkdvivtrepyvscdndncwsfalaqgallgt
khsngtikdrtpyrslirfpigtapvlgnykeiciawsssscfdgkewmhvcmtgndnda
saqiiyggrmtdsikswrkdilrtqesecqcidgtcvvavtdgpaansadyrvywiregk
iikyenvpktkiqyleecscyvdidvycicrdnwkgsnrpwmrinnetiletgyvcskfh
sdtprpadpstmscdspsnvnggpgvkgfgfkagddvwlgrtvstsgrsgfeiikvtegw
inspnhvksitqtlvsnndwsgysgsfivkakdcfqpcfyvelirgrpnknddvswtsns
ivtfcgldnepgsgnwpdgsnigfmpk

SCOPe Domain Coordinates for d4hzza_:

Click to download the PDB-style file with coordinates for d4hzza_.
(The format of our PDB-style files is described here.)

Timeline for d4hzza_: