SCOPe 2.08: Domain d4hzya1: 4hzy A:83-469

Lineage for d4hzya1 (4hzy A:83-469)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.1: Sialidases [50939] (3 families)

5. Family b.68.1.0: automated matches [191452] (1 protein)
   not a true family

6. Protein automated matches [190692] (20 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [188445] (32 PDB entries)

8. Domain d4hzya1: 4hzy A:83-469 [228760]
   Other proteins in same PDB: d4hzya2
   automated match to d2htva_
   complexed with ca

Details for d4hzya1

PDB Entry: 4hzy, 1.6 Å

PDB Description: crystal structure of influenza a neuraminidase n3-h274y

PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d4hzya1:

Sequence; same for both SEQRES and ATOM records:

>d4hzya1 b.68.1.0 (A:83-469) automated matches {Influenza A virus, different strains [TaxId: 11320]}
rpfksplplcpfrgffpfhkdnairlgenkdvivtrepyvscdndncwsfalaqgallgt
khsngtikdrtpyrslirfpigtapvlgnykeiciawsssscfdgkewmhvcmtgndnda
saqiiyggrmtdsikswrkdilrtqesecqcidgtcvvavtdgpaansadyrvywiregk
iikyenvpktkiqyleecscyvdidvycicrdnwkgsnrpwmrinnetiletgyvcskfh
sdtprpadpstmscdspsnvnggpgvkgfgfkagddvwlgrtvstsgrsgfeiikvtegw
inspnhvksitqtlvsnndwsgysgsfivkakdcfqpcfyvelirgrpnknddvswtsns
ivtfcgldnepgsgnwpdgsnigfmpk

Timeline for d4hzya1:

• d4hzya1 first appeared in SCOPe 2.03, called d4hzya_
  
• d4hzya1 appears in SCOPe 2.07