SCOPe 2.01: Domain d2b3ia_: 2b3i A:

Lineage for d2b3ia_ (2b3i A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (16 species)

7. Species Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId:1223] [49521] (3 PDB entries)

8. Domain d2b3ia_: 2b3i A: [22876]
   complexed with cu1

Details for d2b3ia_

PDB Entry: 2b3i

PDB Description: nmr solution structure of plastocyanin from the photosynthetic prokaryote, prochlorothrix hollandica (19 structures)

PDB Compounds: (A:) protein (plastocyanin)

SCOPe Domain Sequences for d2b3ia_:

Sequence; same for both SEQRES and ATOM records:

>d2b3ia_ b.6.1.1 (A:) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]}
asvqikmgtdkyaplyepkalsisagdtvefvmnkvgphnvifdkvpagesapalsntkl
aiapgsfysvtlgtpgtysfyctphrgagmvgtitve

Timeline for d2b3ia_:

• d2b3ia_ first appeared (with stable ids) in SCOP 1.55
  
• d2b3ia_ appears in SCOP 1.75
  
• d2b3ia_ appears in SCOPe 2.02
  
• d2b3ia_ appears in the current release, SCOPe 2.08