Lineage for d1bxva_ (1bxv A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106628Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 106629Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 106630Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 106803Protein Plastocyanin [49507] (14 species)
  7. 106817Species Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId:1143] [49520] (2 PDB entries)
  8. 106818Domain d1bxva_: 1bxv A: [22875]

Details for d1bxva_

PDB Entry: 1bxv (more details), 1.8 Å

PDB Description: reduced plastocyanin from synechococcus sp.

SCOP Domain Sequences for d1bxva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxva_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942}
qtvaikmgadngmlafepstieiqagdtvqwvnnklaphnvvvegqpelshkdlafspge
tfeatfsepgtytyycephrgagmvgkivvq

SCOP Domain Coordinates for d1bxva_:

Click to download the PDB-style file with coordinates for d1bxva_.
(The format of our PDB-style files is described here.)

Timeline for d1bxva_: