Lineage for d1bxva_ (1bxv A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins) 
Protein Plastocyanin [49507] (14 species) 
Species Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId:1143] [49520] (2 PDB entries) 
Domain d1bxva_: 1bxv A: [22875]
Details for d1bxva_
PDB Entry: 1bxv (more details), 1.8 Å
PDB Description: reduced plastocyanin from synechococcus sp.
SCOP Domain Sequences for d1bxva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bxva_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942}
qtvaikmgadngmlafepstieiqagdtvqwvnnklaphnvvvegqpelshkdlafspge
tfeatfsepgtytyycephrgagmvgkivvq
SCOP Domain Coordinates for d1bxva_:
Click to download the PDB-style file with coordinates for d1bxva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bxva_:
- d1bxva_ appears in SCOP 1.57
- d1bxva_ appears in the current release, SCOPe 2.08
View in 3D