SCOPe 2.08: Domain d1bxva_: 1bxv A:

Lineage for d1bxva_ (1bxv A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (17 species)

7. Species Synechocystis sp., pcc 7942 [TaxId:1143] [49520] (4 PDB entries)

8. Domain d1bxva_: 1bxv A: [22875]
   complexed with cu

Details for d1bxva_

PDB Entry: 1bxv, 1.8 Å

PDB Description: reduced plastocyanin from synechococcus sp.

PDB Compounds: (A:) plastocyanin

SCOPe Domain Sequences for d1bxva_:

Sequence; same for both SEQRES and ATOM records:

>d1bxva_ b.6.1.1 (A:) Plastocyanin {Synechocystis sp., pcc 7942 [TaxId: 1143]}
qtvaikmgadngmlafepstieiqagdtvqwvnnklaphnvvvegqpelshkdlafspge
tfeatfsepgtytyycephrgagmvgkivvq

Timeline for d1bxva_:

• d1bxva_ first appeared (with stable ids) in SCOP 1.55
  
• d1bxva_ appears in SCOPe 2.07